Lineage for d3pcfe_ (3pcf E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2379686Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2379709Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 2379717Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 2379884Domain d3pcfe_: 3pcf E: [22711]
    Other proteins in same PDB: d3pcfm_, d3pcfn_, d3pcfo_, d3pcfp_, d3pcfq_, d3pcfr_
    complexed with bme, fe, fhb

Details for d3pcfe_

PDB Entry: 3pcf (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3-fluro-4- hydroxybenzoate
PDB Compounds: (E:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcfe_ b.3.6.1 (E:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d3pcfe_:

Click to download the PDB-style file with coordinates for d3pcfe_.
(The format of our PDB-style files is described here.)

Timeline for d3pcfe_: