Lineage for d3pcfc_ (3pcf C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659818Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 660205Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 660206Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 660221Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 660235Species Pseudomonas aeruginosa [TaxId:287] [49487] (21 PDB entries)
  8. 660280Domain d3pcfc_: 3pcf C: [22709]
    Other proteins in same PDB: d3pcfm_, d3pcfn_, d3pcfo_, d3pcfp_, d3pcfq_, d3pcfr_

Details for d3pcfc_

PDB Entry: 3pcf (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3-fluro-4- hydroxybenzoate
PDB Compounds: (C:) protocatechuate 3,4-dioxygenase

SCOP Domain Sequences for d3pcfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcfc_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas aeruginosa [TaxId: 287]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOP Domain Coordinates for d3pcfc_:

Click to download the PDB-style file with coordinates for d3pcfc_.
(The format of our PDB-style files is described here.)

Timeline for d3pcfc_: