Lineage for d3pckd_ (3pck D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552997Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 553342Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 553343Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 553358Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 553365Species Pseudomonas aeruginosa [TaxId:287] [49487] (15 PDB entries)
  8. 553411Domain d3pckd_: 3pck D: [22704]
    Other proteins in same PDB: d3pckm_, d3pckn_, d3pcko_, d3pckp_, d3pckq_, d3pckr_

Details for d3pckd_

PDB Entry: 3pck (more details), 2.13 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 6-hydroxynicotinic acid n-oxide

SCOP Domain Sequences for d3pckd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pckd_ b.3.6.1 (D:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas aeruginosa}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOP Domain Coordinates for d3pckd_:

Click to download the PDB-style file with coordinates for d3pckd_.
(The format of our PDB-style files is described here.)

Timeline for d3pckd_: