Lineage for d3pcje_ (3pcj E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2042612Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2042613Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2042636Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 2042644Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 2042748Domain d3pcje_: 3pcj E: [22699]
    Other proteins in same PDB: d3pcjm_, d3pcjn_, d3pcjo_, d3pcjp_, d3pcjq_, d3pcjr_
    complexed with bme, fe, ino

Details for d3pcje_

PDB Entry: 3pcj (more details), 2.13 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 2-hydroxyisonicotinic acid n-oxide
PDB Compounds: (E:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcje_ b.3.6.1 (E:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d3pcje_:

Click to download the PDB-style file with coordinates for d3pcje_.
(The format of our PDB-style files is described here.)

Timeline for d3pcje_: