Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins) sandwich; 9 strands in 2 sheets |
Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
Species Pseudomonas putida [TaxId:303] [49487] (21 PDB entries) |
Domain d3pcjb_: 3pcj B: [22696] Other proteins in same PDB: d3pcjm_, d3pcjn_, d3pcjo_, d3pcjp_, d3pcjq_, d3pcjr_ |
PDB Entry: 3pcj (more details), 2.13 Å
SCOP Domain Sequences for d3pcjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pcjb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]} piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk tayrfdiriqgegetvffdf
Timeline for d3pcjb_: