Lineage for d3pcid_ (3pci D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659818Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 660205Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 660206Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 660221Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 660235Species Pseudomonas aeruginosa [TaxId:287] [49487] (21 PDB entries)
  8. 660287Domain d3pcid_: 3pci D: [22692]
    Other proteins in same PDB: d3pcim_, d3pcin_, d3pcio_, d3pcip_, d3pciq_, d3pcir_

Details for d3pcid_

PDB Entry: 3pci (more details), 2.21 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3-iodo-4-hydroxybenzoate
PDB Compounds: (D:) protocatechuate 3,4-dioxygenase

SCOP Domain Sequences for d3pcid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcid_ b.3.6.1 (D:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas aeruginosa [TaxId: 287]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOP Domain Coordinates for d3pcid_:

Click to download the PDB-style file with coordinates for d3pcid_.
(The format of our PDB-style files is described here.)

Timeline for d3pcid_: