Lineage for d3pcdf_ (3pcd F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10679Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 10680Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins)
  6. 10691Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
  7. 10698Species Pseudomonas aeruginosa [TaxId:287] [49487] (15 PDB entries)
  8. 10746Domain d3pcdf_: 3pcd F: [22688]
    Other proteins in same PDB: d3pcdm_, d3pcdn_, d3pcdo_, d3pcdp_, d3pcdq_, d3pcdr_

Details for d3pcdf_

PDB Entry: 3pcd (more details), 2.1 Å

PDB Description: protocatechuate 3,4-dioxygenase y447h mutant

SCOP Domain Sequences for d3pcdf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcdf_ b.3.6.1 (F:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas aeruginosa}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOP Domain Coordinates for d3pcdf_:

Click to download the PDB-style file with coordinates for d3pcdf_.
(The format of our PDB-style files is described here.)

Timeline for d3pcdf_: