Lineage for d3pcaf_ (3pca F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2379686Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2379709Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 2379717Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 2379792Domain d3pcaf_: 3pca F: [22676]
    Other proteins in same PDB: d3pcam_, d3pcan_, d3pcao_, d3pcap_, d3pcaq_, d3pcar_
    complexed with bme, dhb, fe

Details for d3pcaf_

PDB Entry: 3pca (more details), 2.2 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3,4-dihydroxybenzoate
PDB Compounds: (F:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcaf_ b.3.6.1 (F:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d3pcaf_:

Click to download the PDB-style file with coordinates for d3pcaf_.
(The format of our PDB-style files is described here.)

Timeline for d3pcaf_: