| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
| Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
| Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
| Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries) |
| Domain d3pchc_: 3pch C: [22655] Other proteins in same PDB: d3pchm_, d3pchn_, d3pcho_, d3pchp_, d3pchq_, d3pchr_ complexed with bme, chb, fe |
PDB Entry: 3pch (more details), 2.05 Å
SCOPe Domain Sequences for d3pchc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pchc_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf
Timeline for d3pchc_: