![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
![]() | Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
![]() | Protein Catechol 1,2-dioxygenase [49484] (1 species) contains alpha-helical dimerization subdomain at the N-terminus |
![]() | Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries) |
![]() | Domain d1dlmb_: 1dlm B: [22638] complexed with fe, lio |
PDB Entry: 1dlm (more details), 2 Å
SCOPe Domain Sequences for d1dlmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlmb_ b.3.6.1 (B:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]} vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq vvdrprlav
Timeline for d1dlmb_: