SCOPe 2.05: Domain d1dlma_: 1dlm A:

Lineage for d1dlma_ (1dlm A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Catechol 1,2-dioxygenase [49484] (1 species)
   contains alpha-helical dimerization subdomain at the N-terminus

7. Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries)

8. Domain d1dlma_: 1dlm A: [22637]
   complexed with fe, lio

Details for d1dlma_

PDB Entry: 1dlm, 2 Å

PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data

PDB Compounds: (A:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d1dlma_:

Sequence; same for both SEQRES and ATOM records:

>d1dlma_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav

Timeline for d1dlma_:

• d1dlma_ first appeared (with stable ids) in SCOP 1.55
  
• d1dlma_ appears in SCOPe 2.04
  
• d1dlma_ appears in SCOPe 2.06
  
• d1dlma_ appears in the current release, SCOPe 2.08