Lineage for d1dlta_ (1dlt A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55519Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 55707Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 55708Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins)
  6. 55709Protein Catechol 1,2-dioxygenase [49484] (1 species)
  7. 55710Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries)
  8. 55713Domain d1dlta_: 1dlt A: [22635]

Details for d1dlta_

PDB Entry: 1dlt (more details), 1.9 Å

PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 with bound catechol

SCOP Domain Sequences for d1dlta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlta_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav

SCOP Domain Coordinates for d1dlta_:

Click to download the PDB-style file with coordinates for d1dlta_.
(The format of our PDB-style files is described here.)

Timeline for d1dlta_: