Lineage for d1dlta_ (1dlt A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) 
Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins) Protein Catechol 1,2-dioxygenase [49484] (1 species) Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries) 
Domain d1dlta_: 1dlt A: [22635]
Details for d1dlta_
PDB Entry: 1dlt (more details), 1.9 Å
PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 with bound catechol
SCOP Domain Sequences for d1dlta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlta_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav
SCOP Domain Coordinates for d1dlta_:
Click to download the PDB-style file with coordinates for d1dlta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dlta_:
- d1dlta_ appears in SCOP 1.57
- d1dlta_ appears in the current release, SCOPe 2.08
View in 3D
