Lineage for d1dlta_ (1dlt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769889Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2769890Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2769891Protein Catechol 1,2-dioxygenase [49484] (1 species)
    contains alpha-helical dimerization subdomain at the N-terminus
  7. 2769892Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries)
  8. 2769895Domain d1dlta_: 1dlt A: [22635]
    complexed with caq, fe, lio

Details for d1dlta_

PDB Entry: 1dlt (more details), 1.9 Å

PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 with bound catechol
PDB Compounds: (A:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d1dlta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlta_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav

SCOPe Domain Coordinates for d1dlta_:

Click to download the PDB-style file with coordinates for d1dlta_.
(The format of our PDB-style files is described here.)

Timeline for d1dlta_: