Lineage for d1dmhb_ (1dmh B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2365897Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2365898Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 protein domains)
    sandwich; 9 strands in 2 sheets
  6. 2365899Protein Catechol 1,2-dioxygenase [49484] (1 species)
    contains alpha-helical dimerization subdomain at the N-terminus
  7. 2365900Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries)
  8. 2365902Domain d1dmhb_: 1dmh B: [22634]
    complexed with fe, lio, mct

Details for d1dmhb_

PDB Entry: 1dmh (more details), 1.7 Å

PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 with bound 4-methylcatechol
PDB Compounds: (B:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d1dmhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmhb_ b.3.6.1 (B:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav

SCOPe Domain Coordinates for d1dmhb_:

Click to download the PDB-style file with coordinates for d1dmhb_.
(The format of our PDB-style files is described here.)

Timeline for d1dmhb_: