Lineage for d1dmha_ (1dmh A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368613Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 368882Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 368883Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins)
    sandwich; 9 strands in 2 sheets
  6. 368884Protein Catechol 1,2-dioxygenase [49484] (1 species)
    contains alpha-helical dimerization subdomain at the N-terminus
  7. 368885Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries)
  8. 368886Domain d1dmha_: 1dmh A: [22633]

Details for d1dmha_

PDB Entry: 1dmh (more details), 1.7 Å

PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 with bound 4-methylcatechol

SCOP Domain Sequences for d1dmha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmha_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav

SCOP Domain Coordinates for d1dmha_:

Click to download the PDB-style file with coordinates for d1dmha_.
(The format of our PDB-style files is described here.)

Timeline for d1dmha_: