Lineage for d1d2pa3 (1d2p A:722-811)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10667Superfamily b.3.5: B repeat unit of collagen binding surface protein (cna) [49478] (1 family) (S)
  5. 10668Family b.3.5.1: B repeat unit of collagen binding surface protein (cna) [49479] (1 protein)
  6. 10669Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species)
  7. 10670Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries)
  8. 10677Domain d1d2pa3: 1d2p A:722-811 [22631]

Details for d1d2pa3

PDB Entry: 1d2p (more details), 2.5 Å

PDB Description: crystal structure of two b repeat units (b1b2) of the collagen binding protein (cna) of staphylococcus aureus

SCOP Domain Sequences for d1d2pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2pa3 b.3.5.1 (A:722-811) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus}
ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
kkieytvtedhvkdyttdingttitnkytp

SCOP Domain Coordinates for d1d2pa3:

Click to download the PDB-style file with coordinates for d1d2pa3.
(The format of our PDB-style files is described here.)

Timeline for d1d2pa3: