SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1d2pa3 (1d2p A:722-811)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035686Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) (S)
  5. 2035687Family b.3.5.1: Cna protein B-type domain [49479] (4 protein domains)
    Pfam PF05738
  6. 2035688Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species)
    duplication: consists of two similar prealbumin-like domains
  7. 2035689Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries)
  8. 2035696Domain d1d2pa3: 1d2p A:722-811 [22631]
    two b repeat units (b1b2)

Details for d1d2pa3

PDB Entry: 1d2p (more details), 2.5 Å

PDB Description: crystal structure of two b repeat units (b1b2) of the collagen binding protein (cna) of staphylococcus aureus
PDB Compounds: (A:) collagen adhesin

SCOPe Domain Sequences for d1d2pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2pa3 b.3.5.1 (A:722-811) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus [TaxId: 1280]}
ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
kkieytvtedhvkdyttdingttitnkytp

SCOPe Domain Coordinates for d1d2pa3:

Click to download the PDB-style file with coordinates for d1d2pa3.
(The format of our PDB-style files is described here.)

Timeline for d1d2pa3: