Lineage for d1d2pa3 (1d2p A:722-811)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769819Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) (S)
  5. 2769820Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
    Pfam PF05738
  6. 2769821Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species)
    duplication: consists of two similar prealbumin-like domains
  7. 2769822Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries)
  8. 2769825Domain d1d2pa3: 1d2p A:722-811 [22631]
    two b repeat units (b1b2)

Details for d1d2pa3

PDB Entry: 1d2p (more details), 2.5 Å

PDB Description: crystal structure of two b repeat units (b1b2) of the collagen binding protein (cna) of staphylococcus aureus
PDB Compounds: (A:) collagen adhesin

SCOPe Domain Sequences for d1d2pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2pa3 b.3.5.1 (A:722-811) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus [TaxId: 1280]}
ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
kkieytvtedhvkdyttdingttitnkytp

SCOPe Domain Coordinates for d1d2pa3:

Click to download the PDB-style file with coordinates for d1d2pa3.
(The format of our PDB-style files is described here.)

Timeline for d1d2pa3: