| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) ![]() |
| Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins) Pfam PF05738 |
| Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species) duplication: consists of two similar prealbumin-like domains |
| Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries) |
| Domain d1d2pa2: 1d2p A:625-721 [22630] two b repeat units (b1b2) |
PDB Entry: 1d2p (more details), 2.5 Å
SCOPe Domain Sequences for d1d2pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2pa2 b.3.5.1 (A:625-721) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus [TaxId: 1280]}
getsatvtknwddnnnqdgkrpteikvelyqdgkatgktailnesnnwthtwtgldekak
gqqvkytveeltkvkgytthvdnndmgnlittnkytp
Timeline for d1d2pa2: