Class b: All beta proteins [48724] (176 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain [49478] (1 family) |
Family b.3.5.1: Cna protein B-type domain [49479] (2 proteins) Pfam PF05738 |
Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species) duplication: consists of two similar prealbumin-like domains |
Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries) |
Domain d1d2pa1: 1d2p A:535-624 [22629] two b repeat units (b1b2) |
PDB Entry: 1d2p (more details), 2.5 Å
SCOPe Domain Sequences for d1d2pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2pa1 b.3.5.1 (A:535-624) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus [TaxId: 1280]} ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg kkieytvtedhvkdyttdingttitnkytp
Timeline for d1d2pa1: