Lineage for d1d2pa1 (1d2p A:535-624)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1773591Superfamily b.3.5: Cna protein B-type domain [49478] (1 family) (S)
  5. 1773592Family b.3.5.1: Cna protein B-type domain [49479] (2 proteins)
    Pfam PF05738
  6. 1773593Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species)
    duplication: consists of two similar prealbumin-like domains
  7. 1773594Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries)
  8. 1773599Domain d1d2pa1: 1d2p A:535-624 [22629]
    two b repeat units (b1b2)

Details for d1d2pa1

PDB Entry: 1d2p (more details), 2.5 Å

PDB Description: crystal structure of two b repeat units (b1b2) of the collagen binding protein (cna) of staphylococcus aureus
PDB Compounds: (A:) collagen adhesin

SCOPe Domain Sequences for d1d2pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2pa1 b.3.5.1 (A:535-624) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus [TaxId: 1280]}
ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
kkieytvtedhvkdyttdingttitnkytp

SCOPe Domain Coordinates for d1d2pa1:

Click to download the PDB-style file with coordinates for d1d2pa1.
(The format of our PDB-style files is described here.)

Timeline for d1d2pa1: