SCOPe 2.06: Domain d1d2ob1: 1d2o B:535-624

Lineage for d1d2ob1 (1d2o B:535-624)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.5: Cna protein B-type domain [49478] (2 families)

5. Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
   Pfam PF05738

6. Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species)
   duplication: consists of two similar prealbumin-like domains

7. Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries)

8. Domain d1d2ob1: 1d2o B:535-624 [22627]
   a single b repeat unit (b1)

Details for d1d2ob1

PDB Entry: 1d2o, 2 Å

PDB Description: crystal structure of a single b repeat unit (b1) of collagen binding surface protein (cna) of staphylococcus aureus.

PDB Compounds: (B:) collagen adhesin

SCOPe Domain Sequences for d1d2ob1:

Sequence; same for both SEQRES and ATOM records:

>d1d2ob1 b.3.5.1 (B:535-624) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus [TaxId: 1280]}
ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
kkieytvtedhvkdyttdingttitnkytp

Timeline for d1d2ob1:

• d1d2ob1 first appeared (with stable ids) in SCOP 1.55
  
• d1d2ob1 appears in SCOPe 2.05
  
• d1d2ob1 appears in SCOPe 2.07
  
• d1d2ob1 appears in the current release, SCOPe 2.08