SCOP 1.57: Domain d1tfpa_: 1tfp A:

Lineage for d1tfpa_ (1tfp A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [49477] (1 PDB entry)

8. Domain d1tfpa_: 1tfp A: [22623]

Details for d1tfpa_

PDB Entry: 1tfp, 2.9 Å

PDB Description: transthyretin (formerly known as prealbumin)

SCOP Domain Sequences for d1tfpa_:

Sequence; same for both SEQRES and ATOM records:

>d1tfpa_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Chicken (Gallus gallus)}
cplmvkvldavrgspaanvavkvfkkaadgtwqdfatgkttefgeiheltteeqfvegvy
rvefdtssywkglglspfheyadvvftandsghrhytiaallspfsysttavvs

Timeline for d1tfpa_:

• d1tfpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1tfpa_ appears in SCOP 1.59
  
• d1tfpa_ appears in the current release, SCOPe 2.08