Lineage for d1gkec_ (1gke C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10575Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 10576Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 10577Protein Transthyretin (synonym: prealbumin) [49474] (3 species)
  7. 10662Species Rat (Rattus norvegicus) [TaxId:10116] [49476] (1 PDB entry)
  8. 10665Domain d1gkec_: 1gke C: [22621]

Details for d1gkec_

PDB Entry: 1gke (more details), 2.5 Å

PDB Description: rat transthyretin

SCOP Domain Sequences for d1gkec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkec_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Rat (Rattus norvegicus)}
skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn

SCOP Domain Coordinates for d1gkec_:

Click to download the PDB-style file with coordinates for d1gkec_.
(The format of our PDB-style files is described here.)

Timeline for d1gkec_: