SCOP 1.69: Domain d1qabb_: 1qab B:

Lineage for d1qabb_ (1qab B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (48 PDB entries)

8. Domain d1qabb_: 1qab B: [22616]
   Other proteins in same PDB: d1qabe_, d1qabf_

Details for d1qabb_

PDB Entry: 1qab, 3.2 Å

PDB Description: The structure of human retinol binding protein with its carrier protein transthyretin reveals interaction with the carboxy terminus of RBP

SCOP Domain Sequences for d1qabb_:

Sequence; same for both SEQRES and ATOM records:

>d1qabb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke

Timeline for d1qabb_:

• d1qabb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qabb_ appears in SCOP 1.67
  
• d1qabb_ appears in SCOP 1.71
  
• d1qabb_ appears in the current release, SCOPe 2.08