Lineage for d1rlbb_ (1rlb B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1526161Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1526416Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1526417Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 1526418Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 1526439Species Human (Homo sapiens) [TaxId:9606] [49475] (190 PDB entries)
    Uniprot P02766 31-143
  8. 1526853Domain d1rlbb_: 1rlb B: [22612]
    Other proteins in same PDB: d1rlbe_, d1rlbf_
    complexed with rea

Details for d1rlbb_

PDB Entry: 1rlb (more details), 3.1 Å

PDB Description: retinol binding protein complexed with transthyretin
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d1rlbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlbb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
skcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfveg
iykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke

SCOPe Domain Coordinates for d1rlbb_:

Click to download the PDB-style file with coordinates for d1rlbb_.
(The format of our PDB-style files is described here.)

Timeline for d1rlbb_: