SCOP 1.73: Domain d5ttrc_: 5ttr C:

Lineage for d5ttrc_ (5ttr C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (67 PDB entries)

8. Domain d5ttrc_: 5ttr C: [22605]

Details for d5ttrc_

PDB Entry: 5ttr, 2.7 Å

PDB Description: leu 55 pro transthyretin crystal structure

PDB Compounds: (C:) Transthyretin

SCOP Domain Sequences for d5ttrc_:

Sequence; same for both SEQRES and ATOM records:

>d5ttrc_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d5ttrc_:

• d5ttrc_ first appeared (with stable ids) in SCOP 1.55
  
• d5ttrc_ appears in SCOP 1.71
  
• d5ttrc_ appears in SCOP 1.75
  
• d5ttrc_ appears in the current release, SCOPe 2.08