SCOP 1.69: Domain d2roya_: 2roy A:

Lineage for d2roya_ (2roy A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (48 PDB entries)

8. Domain d2roya_: 2roy A: [22599]

Details for d2roya_

PDB Entry: 2roy, 2.2 Å

PDB Description: transthyretin (also called prealbumin) complex with 3',5'-dinitro-n- acetyl-l-thyronine

SCOP Domain Sequences for d2roya_:

Sequence; same for both SEQRES and ATOM records:

>d2roya_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
eskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefve
giykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpk
e

Timeline for d2roya_:

• d2roya_ first appeared (with stable ids) in SCOP 1.55
  
• d2roya_ appears in SCOP 1.67
  
• d2roya_ appears in SCOP 1.71
  
• d2roya_ appears in the current release, SCOPe 2.08