SCOP 1.75: Domain d2trya_: 2try A:

Lineage for d2trya_ (2try A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (79 PDB entries)
   Uniprot P02766 31-143

8. Domain d2trya_: 2try A: [22595]

Details for d2trya_

PDB Entry: 2try, 2 Å

PDB Description: tertiary structures of three amyloidogenic transthyretin variants and implications for amyloid fibril formation

PDB Compounds: (A:) Transthyretin

SCOP Domain Sequences for d2trya_:

Sequence; same for both SEQRES and ATOM records:

>d2trya_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtkyywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke

Timeline for d2trya_:

• d2trya_ first appeared (with stable ids) in SCOP 1.55
  
• d2trya_ appears in SCOP 1.73
  
• d2trya_ appears in SCOPe 2.01
  
• d2trya_ appears in the current release, SCOPe 2.08