Lineage for d1bz8b_ (1bz8 B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10575Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 10576Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 10577Protein Transthyretin (synonym: prealbumin) [49474] (3 species)
  7. 10581Species Human (Homo sapiens) [TaxId:9606] [49475] (35 PDB entries)
  8. 10633Domain d1bz8b_: 1bz8 B: [22592]

Details for d1bz8b_

PDB Entry: 1bz8 (more details), 2 Å

PDB Description: transthyretin (del val122)

SCOP Domain Sequences for d1bz8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz8b_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vtnpke

SCOP Domain Coordinates for d1bz8b_:

Click to download the PDB-style file with coordinates for d1bz8b_.
(The format of our PDB-style files is described here.)

Timeline for d1bz8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bz8a_