![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) ![]() |
![]() | Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein) |
![]() | Protein Transthyretin (synonym: prealbumin) [49474] (4 species) sandwich; 8 strands in 2 sheets |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49475] (67 PDB entries) |
![]() | Domain d1bzdb_: 1bzd B: [22576] mutant |
PDB Entry: 1bzd (more details), 1.9 Å
SCOP Domain Sequences for d1bzdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzdb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]} gptgtseskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta vvtnpke
Timeline for d1bzdb_: