SCOPe 2.01: Domain d1e3fa_: 1e3f A:

Lineage for d1e3fa_ (1e3f A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (141 PDB entries)
   Uniprot P02766 31-143

8. Domain d1e3fa_: 1e3f A: [22569]

Details for d1e3fa_

PDB Entry: 1e3f, 1.9 Å

PDB Description: structure of human transthyretin complexed with bromophenols: a new mode of binding

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d1e3fa_:

Sequence; same for both SEQRES and ATOM records:

>d1e3fa_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d1e3fa_:

• d1e3fa_ first appeared (with stable ids) in SCOP 1.55
  
• d1e3fa_ appears in SCOP 1.75
  
• d1e3fa_ appears in SCOPe 2.02
  
• d1e3fa_ appears in the current release, SCOPe 2.08