Lineage for d1dvza_ (1dvz A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) 
Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein) Protein Transthyretin (synonym: prealbumin) [49474] (3 species) Species Human (Homo sapiens) [TaxId:9606] [49475] (35 PDB entries) 
Domain d1dvza_: 1dvz A: [22567]
Details for d1dvza_
PDB Entry: 1dvz (more details), 1.9 Å
PDB Description: crystal structure of human transthyretin in complex with o-trifluoromethylphenyl anthranilic acid
SCOP Domain Sequences for d1dvza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvza_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
SCOP Domain Coordinates for d1dvza_:
Click to download the PDB-style file with coordinates for d1dvza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dvza_:
- d1dvza_ appears in SCOP 1.57
- d1dvza_ appears in the current release, SCOPe 2.08
View in 3D
