SCOP 1.69: Domain d1dvya_: 1dvy A:

Lineage for d1dvya_ (1dvy A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (48 PDB entries)

8. Domain d1dvya_: 1dvy A: [22565]

Details for d1dvya_

PDB Entry: 1dvy, 1.9 Å

PDB Description: crystal structure of transthyretin in complex with n-(m-trifluoromethylphenyl) phenoxazine-4,6-dicarboxylic acid

SCOP Domain Sequences for d1dvya_:

Sequence; same for both SEQRES and ATOM records:

>d1dvya_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d1dvya_:

• d1dvya_ first appeared (with stable ids) in SCOP 1.55
  
• d1dvya_ appears in SCOP 1.67
  
• d1dvya_ appears in SCOP 1.71
  
• d1dvya_ appears in the current release, SCOPe 2.08