SCOPe 2.02: Domain d1bzeb_: 1bze B:

Lineage for d1bzeb_ (1bze B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (150 PDB entries)
   Uniprot P02766 31-143

8. Domain d1bzeb_: 1bze B: [22564]

Details for d1bzeb_

PDB Entry: 1bze, 1.8 Å

PDB Description: tertiary structures of three amyloidogenic transthyretin variants and implications for amyloid fibril formation

PDB Compounds: (B:) protein (transthyretin)

SCOPe Domain Sequences for d1bzeb_:

Sequence; same for both SEQRES and ATOM records:

>d1bzeb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystma
vvtnpke

Timeline for d1bzeb_:

• d1bzeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bzeb_ appears in SCOPe 2.01
  
• d1bzeb_ appears in SCOPe 2.03
  
• d1bzeb_ appears in the current release, SCOPe 2.08