SCOP 1.67: Domain d1tlmb_: 1tlm B:

Lineage for d1tlmb_ (1tlm B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (45 PDB entries)

8. Domain d1tlmb_: 1tlm B: [22560]
   complexed with mil

Details for d1tlmb_

PDB Entry: 1tlm, 1.9 Å

PDB Description: structural aspects of inotropic bipyridine binding: crystal structure determination to 1.9 angstroms of the human serum transthyretin- milrinone complex

SCOP Domain Sequences for d1tlmb_:

Sequence; same for both SEQRES and ATOM records:

>d1tlmb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
skcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfveg
iykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke

Timeline for d1tlmb_:

• d1tlmb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tlmb_ appears in SCOP 1.65
  
• d1tlmb_ appears in SCOP 1.69
  
• d1tlmb_ appears in the current release, SCOPe 2.08