SCOP 1.75: Domain d1dvua_: 1dvu A:

Lineage for d1dvua_ (1dvu A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (79 PDB entries)
   Uniprot P02766 31-143

8. Domain d1dvua_: 1dvu A: [22557]

Details for d1dvua_

PDB Entry: 1dvu, 1.9 Å

PDB Description: crystal structure of human transthyretin in complex with dibenzofuran-4,6-dicarboxylic acid

PDB Compounds: (A:) Transthyretin

SCOP Domain Sequences for d1dvua_:

Sequence; same for both SEQRES and ATOM records:

>d1dvua_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d1dvua_:

• d1dvua_ first appeared (with stable ids) in SCOP 1.55
  
• d1dvua_ appears in SCOP 1.73
  
• d1dvua_ appears in SCOPe 2.01
  
• d1dvua_ appears in the current release, SCOPe 2.08