SCOP 1.67: Domain d1e4hb_: 1e4h B:

Lineage for d1e4hb_ (1e4h B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (45 PDB entries)

8. Domain d1e4hb_: 1e4h B: [22554]
   complexed with gol, pbr

Details for d1e4hb_

PDB Entry: 1e4h, 1.8 Å

PDB Description: structure of human transthyretin complexed with bromophenols: a new mode of binding

SCOP Domain Sequences for d1e4hb_:

Sequence; same for both SEQRES and ATOM records:

>d1e4hb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d1e4hb_:

• d1e4hb_ first appeared (with stable ids) in SCOP 1.55
  
• d1e4hb_ appears in SCOP 1.65
  
• d1e4hb_ appears in SCOP 1.69
  
• d1e4hb_ appears in the current release, SCOPe 2.08