Lineage for d1tsha_ (1tsh A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 292233Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 292340Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 292341Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 292342Protein Transthyretin (synonym: prealbumin) [49474] (3 species)
    sandwich; 8 strands in 2 sheets
  7. 292346Species Human (Homo sapiens) [TaxId:9606] [49475] (45 PDB entries)
  8. 292361Domain d1tsha_: 1tsh A: [22549]

Details for d1tsha_

PDB Entry: 1tsh (more details), 1.7 Å

PDB Description: tertiary structures of three amyloidogenic transthyretin variants and implications for amyloid fibril formation

SCOP Domain Sequences for d1tsha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tsha_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke

SCOP Domain Coordinates for d1tsha_:

Click to download the PDB-style file with coordinates for d1tsha_.
(The format of our PDB-style files is described here.)

Timeline for d1tsha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tshb_