SCOPe 2.08: Domain d1ttaa_: 1tta A:

Lineage for d1ttaa_ (1tta A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d1ttaa_: 1tta A: [22545]

Details for d1ttaa_

PDB Entry: 1tta, 1.7 Å

PDB Description: the x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic val30met variant to 1.7 angstroms resolution

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d1ttaa_:

Sequence; same for both SEQRES and ATOM records:

>d1ttaa_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke

Timeline for d1ttaa_:

• d1ttaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ttaa_ appears in SCOPe 2.07