Lineage for d1etb2_ (1etb 2:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1526161Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1526416Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1526417Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 1526418Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 1526439Species Human (Homo sapiens) [TaxId:9606] [49475] (190 PDB entries)
    Uniprot P02766 31-143
  8. 1526549Domain d1etb2_: 1etb 2: [22542]
    complexed with t44

Details for d1etb2_

PDB Entry: 1etb (more details), 1.7 Å

PDB Description: the x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic val 30-->met variant to 1.7 angstroms resolution
PDB Compounds: (2:) Transthyretin

SCOPe Domain Sequences for d1etb2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etb2_ b.3.4.1 (2:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
ykveidtksywkalgispfhehaevvftandsgprrytiatllspysysttavvtnp

SCOPe Domain Coordinates for d1etb2_:

Click to download the PDB-style file with coordinates for d1etb2_.
(The format of our PDB-style files is described here.)

Timeline for d1etb2_: