SCOP 1.57: Domain d1etb2_: 1etb 2:

Lineage for d1etb2_ (1etb 2:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (38 PDB entries)

8. Domain d1etb2_: 1etb 2: [22542]

Details for d1etb2_

PDB Entry: 1etb, 1.7 Å

PDB Description: the x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic val 30-->met variant to 1.7 angstroms resolution

SCOP Domain Sequences for d1etb2_:

Sequence; same for both SEQRES and ATOM records:

>d1etb2_ b.3.4.1 (2:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
ykveidtksywkalgispfhehaevvftandsgprrytiatllspysysttavvtnp

Timeline for d1etb2_:

• d1etb2_ first appeared (with stable ids) in SCOP 1.55
  
• d1etb2_ appears in SCOP 1.59
  
• d1etb2_ appears in the current release, SCOPe 2.08