![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) ![]() |
![]() | Family b.3.2.1: Carboxypeptidase regulatory domain [49465] (2 proteins) |
![]() | Protein Carboxypeptidase D C-terminal domain [49466] (1 species) |
![]() | Species Crested duck (Lophonetta specularioides) [TaxId:8836] [49467] (2 PDB entries) |
![]() | Domain d1qmua1: 1qmu A:305-383 [22534] Other proteins in same PDB: d1qmua2 complexed with so4, zn |
PDB Entry: 1qmu (more details), 2.7 Å
SCOPe Domain Sequences for d1qmua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmua1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} giwgfvldatdgrgilnatisvadinhpvttykdgdywrllvqgtykvtasargydpvtk tvevdskggvqvnftlsrt
Timeline for d1qmua1: