Lineage for d1qmua1 (1qmu A:305-383)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.2: Carboxypeptidase D, a regulatory domain [49464] (1 family) 
Family b.3.2.1: Carboxypeptidase D, a regulatory domain [49465] (1 protein) Protein Carboxypeptidase D, a regulatory domain [49466] (1 species) Species Crested duck (Lophonetta specularioides) [TaxId:8836] [49467] (1 PDB entry) 
Domain d1qmua1: 1qmu A:305-383 [22534]
Other proteins in same PDB: d1qmua2
Details for d1qmua1
PDB Entry: 1qmu (more details), 2.7 Å
PDB Description: duck carboxypeptidase d domain ii
SCOP Domain Sequences for d1qmua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmua1 b.3.2.1 (A:305-383) Carboxypeptidase D, a regulatory domain {Crested duck (Lophonetta specularioides)}
giwgfvldatdgrgilnatisvadinhpvttykdgdywrllvqgtykvtasargydpvtk
tvevdskggvqvnftlsrt
SCOP Domain Coordinates for d1qmua1:
Click to download the PDB-style file with coordinates for d1qmua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qmua1:
- d1qmua1 appears in SCOP 1.57
- d1qmua1 appears in the current release, SCOPe 2.08
View in 3D
