Lineage for d1qmua1 (1qmu A:305-383)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) 
Family b.3.2.1: Carboxypeptidase regulatory domain [49465] (2 proteins) Protein Carboxypeptidase D C-terminal domain [49466] (1 species) Species Crested duck (Lophonetta specularioides) [TaxId:8836] [49467] (2 PDB entries) 
Domain d1qmua1: 1qmu A:305-383 [22534]
Other proteins in same PDB: d1qmua2
complexed with so4, zn
Details for d1qmua1
PDB Entry: 1qmu (more details), 2.7 Å
PDB Description: duck carboxypeptidase d domain ii
PDB Compounds: (A:) carboxypeptidase gp180 residues 503-882SCOPe Domain Sequences for d1qmua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmua1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]}
giwgfvldatdgrgilnatisvadinhpvttykdgdywrllvqgtykvtasargydpvtk
tvevdskggvqvnftlsrt
SCOPe Domain Coordinates for d1qmua1:
Click to download the PDB-style file with coordinates for d1qmua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qmua1:
- d1qmua1 first appeared (with stable ids) in SCOP 1.55
- d1qmua1 appears in SCOPe 2.07
View in 3D
