SCOP 1.75: Domain d1b90a1: 1b90 A:418-516

Lineage for d1b90a1 (1b90 A:418-516)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein beta-amylase [49462] (1 species)

7. Species Bacillus cereus [TaxId:1396] [49463] (15 PDB entries)

8. Domain d1b90a1: 1b90 A:418-516 [22533]
   Other proteins in same PDB: d1b90a2
   complexed with act, ca, so4

Details for d1b90a1

PDB Entry: 1b90, 2.5 Å

PDB Description: bacillus cereus beta-amylase apo form

PDB Compounds: (A:) protein (beta-amylase)

SCOP Domain Sequences for d1b90a1:

Sequence; same for both SEQRES and ATOM records:

>d1b90a1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

Timeline for d1b90a1:

• d1b90a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b90a1 appears in SCOP 1.73
  
• d1b90a1 appears in SCOPe 2.01
  
• d1b90a1 appears in the current release, SCOPe 2.08