Lineage for d1b90a1 (1b90 A:418-516)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.1: Starch-binding domain [49452] (1 family) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) 
Protein beta-amylase [49462] (1 species) Species Bacillus cereus [TaxId:1396] [49463] (4 PDB entries) 
Domain d1b90a1: 1b90 A:418-516 [22533]
Other proteins in same PDB: d1b90a2
Details for d1b90a1
PDB Entry: 1b90 (more details), 2.5 Å
PDB Description: bacillus cereus beta-amylase apo form
SCOP Domain Sequences for d1b90a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b90a1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw
SCOP Domain Coordinates for d1b90a1:
Click to download the PDB-style file with coordinates for d1b90a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b90a1:
- d1b90a1 appears in SCOP 1.57
- d1b90a1 appears in the current release, SCOPe 2.08
View in 3D
