| Class b: All beta proteins [48724] (126 folds) |
| Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain [49452] (1 family) ![]() |
| Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
| Protein beta-amylase [49462] (1 species) |
| Species Bacillus cereus [TaxId:1396] [49463] (11 PDB entries) |
| Domain d5bcad1: 5bca D:418-516 [22532] Other proteins in same PDB: d5bcaa2, d5bcab2, d5bcac2, d5bcad2 complexed with ca |
PDB Entry: 5bca (more details), 2.2 Å
SCOP Domain Sequences for d5bcad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bcad1 b.3.1.1 (D:418-516) beta-amylase {Bacillus cereus}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw
Timeline for d5bcad1: