Lineage for d5bcab1 (5bca B:418-516)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378394Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2378395Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2378396Protein beta-amylase [49462] (1 species)
  7. 2378397Species Bacillus cereus [TaxId:1396] [49463] (12 PDB entries)
  8. 2378423Domain d5bcab1: 5bca B:418-516 [22530]
    Other proteins in same PDB: d5bcaa2, d5bcab2, d5bcac2, d5bcad2
    complexed with ca

Details for d5bcab1

PDB Entry: 5bca (more details), 2.2 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides
PDB Compounds: (B:) protein (1,4-alpha-d-glucan maltohydrolase.)

SCOPe Domain Sequences for d5bcab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bcab1 b.3.1.1 (B:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOPe Domain Coordinates for d5bcab1:

Click to download the PDB-style file with coordinates for d5bcab1.
(The format of our PDB-style files is described here.)

Timeline for d5bcab1: