Lineage for d1b9za1 (1b9z A:418-516)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
automatically mapped to Pfam PF00686
Protein beta-amylase [49462] (1 species) Species Bacillus cereus [TaxId:1396] [49463] (12 PDB entries) 
Domain d1b9za1: 1b9z A:418-516 [22528]
Other proteins in same PDB: d1b9za2
complexed with act, ca, so4
Details for d1b9za1
PDB Entry: 1b9z (more details), 2.1 Å
PDB Description: bacillus cereus beta-amylase complexed with maltose
PDB Compounds: (A:) protein (beta-amylase)SCOPe Domain Sequences for d1b9za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9za1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw
SCOPe Domain Coordinates for d1b9za1:
Click to download the PDB-style file with coordinates for d1b9za1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b9za1:
- d1b9za1 first appeared (with stable ids) in SCOP 1.55
- d1b9za1 appears in SCOPe 2.07
View in 3D
