| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
| Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
| Protein Glucoamylase, granular starch-binding domain [49460] (1 species) |
| Species Aspergillus niger [TaxId:5061] [49461] (5 PDB entries) |
| Domain d1ac0a_: 1ac0 A: [22526] |
PDB Entry: 1ac0 (more details)
SCOPe Domain Sequences for d1ac0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ac0a_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr
Timeline for d1ac0a_: